(data stored in ACNUC10821 zone)

EMBL: AE017262.PE665

AE017262.PE665       Location/Qualifiers
FT   CDS             690734..691384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0674"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03455"
FT                   /protein_id="AAT03455.1"
FT                   /translation="MFLDTGKLEEIKKALQFPFFEGVTTNPTILLKENKPRNTHIANIP
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSSEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHQAALPK"
     MFLDTGKLEE IKKALQFPFF EGVTTNPTIL LKENKPRNTH IANIPAKVVF VQAAGLTEEE        60
     IWEDVLRIQA IEPAEGTVIG LKIPAHEAGI KVIAKVRANF PNEIILATAI FSSEQGYIAA       120
     LSGADYLAPY YNRMEVSGLD AAKTIEELRY VLDLQGLEDV KIMGASFKNS RQIMQALASG       180
     ADTVTIGYDL FLQMMNKPLA LESIEKFNEH QAALPK                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page