(data stored in ACNUC10821 zone)

EMBL: AE017262.PE667

AE017262.PE667       Location/Qualifiers
FT   CDS             693482..694873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0676"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03457"
FT                   /protein_id="AAT03457.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVVIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPFYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
     MNSLFRRKPI EDLMHNKSGS THLKQTLGPL DLTLLGVGAI VGTGIFILPG TVAAKNAGPA        60
     IIFSFVIAAI VCAIAAMCYS EFASSVPVAG SAYTYGYVVF GELIGWLLGW ALILEYGLAV       120
     ASVASGWSSY LNALLSGFHI SIPEAISGPF NPEVGTFINL PAIIIVLVIA FLLTLGIKES       180
     TRVNTIMVVI KVGVILLFLV VGVFYVKPDN WQPFMPFGIS GVMNGAALVF FAYLGFDAVS       240
     SAAEEVKDPQ RTMPIGIIGS LLICTVLYVA VSAVLTGMVP YTDLNVTDPV AYALQVINQD       300
     WVAGIVSLGA VVGMITVILV MSYGATRLIF AMGRDGLLPK VLAEINQKYQ TPVKNTWIFA       360
     VIVAIISGLV PLDRLAELVN IGTLLAFMMV SIGIIFLRKN KDIQARGFKV PFYPVLPIVS       420
     FLLCAFLISR LSVHTWILCG IWFVIGLIVY FAYGRKHSEL LKK                         463
//

If you have problems or comments...

PBIL Back to PBIL home page