(data stored in ACNUC10821 zone)

EMBL: AE017262.PE669

AE017262.PE669       Location/Qualifiers
FT   CDS             complement(695885..696169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0646"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03459"
FT                   /protein_id="AAT03459.1"
FT                   /translation="MEFMSMIVTGIVLAAIISGLSFVVGKLSGLSWFWIAFCANSGFFI
FT                   IFITVQNSFPDNAAVALSYLNLGIGVVLIALTLFQSSNWLFKKTMQRKH"
     MEFMSMIVTG IVLAAIISGL SFVVGKLSGL SWFWIAFCAN SGFFIIFITV QNSFPDNAAV        60
     ALSYLNLGIG VVLIALTLFQ SSNWLFKKTM QRKH                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page