(data stored in ACNUC10821 zone)

EMBL: AE017262.PE671

AE017262.PE671       Location/Qualifiers
FT   CDS             697241..697882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0680"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03461"
FT                   /protein_id="AAT03461.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLHVGQHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMAEILVVQTIEKCKNKNLTYK
FT                   PEQGNALLEEMREIQKEEDVEAYLSLLSKWLLQFVAQLANSYAEDIVRKMKRDFFNKAQ
FT                   KDIKMIPVLLEEETMETLEQLTYYMVEKKHDLAKEVIQKLVNLYIIRTFR"
     MEKQTYEKLA YYTIKEKILS GKLHVGQHIS EAGIAKELSI SRTPVRKAIA VLVSEELIEY        60
     ELNRGAIVIE SSMSAGRFIE LLEMAEILVV QTIEKCKNKN LTYKPEQGNA LLEEMREIQK       120
     EEDVEAYLSL LSKWLLQFVA QLANSYAEDI VRKMKRDFFN KAQKDIKMIP VLLEEETMET       180
     LEQLTYYMVE KKHDLAKEVI QKLVNLYIIR TFR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page