(data stored in ACNUC10821 zone)

EMBL: AE017262.PE674

AE017262.PE674       Location/Qualifiers
FT   CDS             complement(701318..701854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0683"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:PG1761; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03464"
FT                   /protein_id="AAT03464.1"
FT                   /translation="MNQNKITAGGLEFLVRFAAPTDRLKINDLMIDTARWLKESGSTQW
FT                   SDILHGFDVHNIEQRIELGEVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAIDKAYY
FT                   LHRIMVSRAFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNETLNQMYVRYGFQFSG
FT                   KKNGFYLYQKELSQK"
     MNQNKITAGG LEFLVRFAAP TDRLKINDLM IDTARWLKES GSTQWSDILH GFDVHNIEQR        60
     IELGEVALFE TEAGALAGAM IIRKTPSDWD TDLWEDLAID KAYYLHRIMV SRAFSGISLS       120
     KQMIYFAEKL GIEMSVPFIR LDCIESNETL NQMYVRYGFQ FSGKKNGFYL YQKELSQK         178
//

If you have problems or comments...

PBIL Back to PBIL home page