(data stored in ACNUC10821 zone)

EMBL: AE017262.PE675

AE017262.PE675       Location/Qualifiers
FT   CDS             complement(701841..702827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0652; match
FT                   to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03465"
FT                   /protein_id="AAT03465.1"
FT                   /translation="MMTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVGGGLIGWIPV
FT                   IGWIAIFLLTGPLYTGVAWVYLAISRREQPDVAYMFSGFKQFGRTVLAYLLISIFTFLW
FT                   SLLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWY
FT                   LIPLAVAIAGTVIVAGGMATTSYTADPAEVLSALAAGATFGGLVLILASWLITLGISLY
FT                   VYPYLITSIAVFYDDLYAATEGTFTEETVIVEEEVNPFGTTEADPFAEDTHPEGFGPEA
FT                   TKEPETPVVPEAPEAPEAPETPETPEVPETPEAPETPEAPKDNNEPK"
     MMTISQVKQT AKESLRGNWG IAIGIFVLAW LIETVGGGLI GWIPVIGWIA IFLLTGPLYT        60
     GVAWVYLAIS RREQPDVAYM FSGFKQFGRT VLAYLLISIF TFLWSLLLIV PGIIKTYSYS       120
     QTFFILRDNP NISALDAITE SRHMMNGHKG RLFGLSLTFL LWYLIPLAVA IAGTVIVAGG       180
     MATTSYTADP AEVLSALAAG ATFGGLVLIL ASWLITLGIS LYVYPYLITS IAVFYDDLYA       240
     ATEGTFTEET VIVEEEVNPF GTTEADPFAE DTHPEGFGPE ATKEPETPVV PEAPEAPEAP       300
     ETPETPEVPE TPEAPETPEA PKDNNEPK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page