(data stored in ACNUC10821 zone)

EMBL: AE017262.PE677

AE017262.PE677       Location/Qualifiers
FT   CDS             703292..703999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0686"
FT                   /product="serine/threonine protein phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03467"
FT                   /protein_id="AAT03467.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKEQERLLFVGDLIDRGENPA
FT                   AVLRRVKALADQTGAIVLKGNHEQMLLDFLENPSGKMHYYLSQGGMETIQSLIADSLDK
FT                   KMTPEGLAERVKEEAAELIDFIRNLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWI
FT                   REPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVITKSFSVKK"
     MKPIFAVGDV HGEITLLDEL LENWDKEQER LLFVGDLIDR GENPAAVLRR VKALADQTGA        60
     IVLKGNHEQM LLDFLENPSG KMHYYLSQGG METIQSLIAD SLDKKMTPEG LAERVKEEAA       120
     ELIDFIRNLP LYYEEGKYVF VHAGVDLTKK DWHDTEERDF FWIREPFLFG QNKTGKVFIF       180
     GHTPVQNLHI DESSGIWVSE DKTRLDIDGG AVFGGELHGV VVEEKVITKS FSVKK            235
//

If you have problems or comments...

PBIL Back to PBIL home page