(data stored in ACNUC10821 zone)

EMBL: AE017262.PE678

AE017262.PE678       Location/Qualifiers
FT   CDS             704427..706565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HP01062"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03468"
FT                   /protein_id="AAT03468.1"
FT                   /translation="MKIELATRKNVFQEDNIEFKRKNFIFGKNGSGKSTLCDLIKMQKH
FT                   LYQTEMNSNYELVEVKEDGEYVLANNQEEKFDVQIFQGFDSVIGENNNLNAIALSAGNK
FT                   VIEDKLPILNRELEALNDEKKIKNNIYLKAKEKHNFQESKIDNWYSVAAKSIKRNTQYQ
FT                   IDPNYNKRKFKDDINKSKRIENVEELNSIIKETPKNPVVDYFFDIPNLKEILNLVNDIL
FT                   VKTVEIPQKCNELNTSEKEKFARKGLNLHEENDDCLFCGNKLTRDRMNKLNQHFNEGYQ
FT                   KLEEEVLSIEIEKITFQKIKQQEFYAKFDVEEINNIILEKENEINRFLENLLNAINEKK
FT                   EDITKIFNILELEIPQITNLQIKINELIRENNIFGENLNNNIKIAKESIKYHLISIECE
FT                   KFNFNVEKNELNNLKLQIPDLTKINQEIEEKNKEIQELKNQQKDTSKIAQLINERLKKA
FT                   GKDDLQLKKIENDGFERYEIQDGENEVRSINKISTGEKNIIAFLYFIYSLEDIENQKNK
FT                   PKIIIFDDPMNSNDDTMQYLIITELQKLYSGIDKNKFNHEKDYFLCLTHNVHFYLNVQP
FT                   HGNHKDSKGRTKYDKSNFFRIENKKFRLIKNEKEDIKTNYAGLWIELSELCERNLRYAI
FT                   LNSMRRIIETFVKFNNLNTDDFYRENAIYKKLFDVGSHSIDDLTHEQFTETPAELKLIF
FT                   SNLFEENGFEDHFKNYWK"
     MKIELATRKN VFQEDNIEFK RKNFIFGKNG SGKSTLCDLI KMQKHLYQTE MNSNYELVEV        60
     KEDGEYVLAN NQEEKFDVQI FQGFDSVIGE NNNLNAIALS AGNKVIEDKL PILNRELEAL       120
     NDEKKIKNNI YLKAKEKHNF QESKIDNWYS VAAKSIKRNT QYQIDPNYNK RKFKDDINKS       180
     KRIENVEELN SIIKETPKNP VVDYFFDIPN LKEILNLVND ILVKTVEIPQ KCNELNTSEK       240
     EKFARKGLNL HEENDDCLFC GNKLTRDRMN KLNQHFNEGY QKLEEEVLSI EIEKITFQKI       300
     KQQEFYAKFD VEEINNIILE KENEINRFLE NLLNAINEKK EDITKIFNIL ELEIPQITNL       360
     QIKINELIRE NNIFGENLNN NIKIAKESIK YHLISIECEK FNFNVEKNEL NNLKLQIPDL       420
     TKINQEIEEK NKEIQELKNQ QKDTSKIAQL INERLKKAGK DDLQLKKIEN DGFERYEIQD       480
     GENEVRSINK ISTGEKNIIA FLYFIYSLED IENQKNKPKI IIFDDPMNSN DDTMQYLIIT       540
     ELQKLYSGID KNKFNHEKDY FLCLTHNVHF YLNVQPHGNH KDSKGRTKYD KSNFFRIENK       600
     KFRLIKNEKE DIKTNYAGLW IELSELCERN LRYAILNSMR RIIETFVKFN NLNTDDFYRE       660
     NAIYKKLFDV GSHSIDDLTH EQFTETPAEL KLIFSNLFEE NGFEDHFKNY WK               712
//

If you have problems or comments...

PBIL Back to PBIL home page