(data stored in ACNUC10821 zone)

EMBL: AE017262.PE679

AE017262.PE679       Location/Qualifiers
FT   CDS             complement(706695..707258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0688"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04238"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03469"
FT                   /protein_id="AAT03469.1"
FT                   /translation="MEQNKEKLTKPTSEKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNIKMHRGFILAAFTSTLFFLVTYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
     MEQNKEKLTK PTSEKNYFWP IMIISFVAVV VILLLFFSPI GYQGAVHFDI TIFPRMNAIF        60
     NSFTFVFLVI ALWAIIKKKN IKMHRGFILA AFTSTLFFLV TYLTFHYLSA ETSTFGGTGI       120
     IRPIYFFILI THSFLAAIVV PLALFALVWG WTMQIEKHKK IVRWTMPIWL YVSLTGVLVY       180
     LFMAPYY                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page