(data stored in ACNUC10821 zone)

EMBL: AE017262.PE68

AE017262.PE68        Location/Qualifiers
FT   CDS             70845..71096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02858"
FT                   /protein_id="AAT02858.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
     MAKNTHMNVT VDFTNWGASK YDLRIPVHQP IKALIINLAE TLKIDYKDLS KCTIKTTNKA        60
     ILLSDDDKLT NFQIADGDIL EIL                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page