(data stored in ACNUC10821 zone)

EMBL: AE017262.PE681

AE017262.PE681       Location/Qualifiers
FT   CDS             707837..708466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0690"
FT                   /product="endonuclease III domain protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03471"
FT                   /protein_id="AAT03471.1"
FT                   /translation="MNVNEQKVLVLNNLVEHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLAPYLDLDSLIEMDKAKLEELIYPAGFYKQKSIYIKALAEWFYGHGASLDK
FT                   FQTYSTEALRKELLGIKGVGEETADAMLLYIFERNVFIADLYARRLFTRLGFGEYTTYA
FT                   QMRDEFMPIIENIPHKLCKEWHSVIDVHGKHFGKDKSMNESWLLES"
     MNVNEQKVLV LNNLVEHYGY QDWWEADNRL ADWLSMILIQ RTTEKNAKQA LANLAPYLDL        60
     DSLIEMDKAK LEELIYPAGF YKQKSIYIKA LAEWFYGHGA SLDKFQTYST EALRKELLGI       120
     KGVGEETADA MLLYIFERNV FIADLYARRL FTRLGFGEYT TYAQMRDEFM PIIENIPHKL       180
     CKEWHSVIDV HGKHFGKDKS MNESWLLES                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page