(data stored in ACNUC10821 zone)

EMBL: AE017262.PE682

AE017262.PE682       Location/Qualifiers
FT   CDS             complement(708463..709359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0691"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03472"
FT                   /protein_id="AAT03472.1"
FT                   /translation="MVGYGKTVRDIRTSKGIHQKDLYDNIISKSFAIEFEKGKHDITLT
FT                   LFEKILKRMNMDLDEFFYIHRELSVSAEKNYLCMNQERGNIYDLASLELLYNELSKHNG
FT                   ELVEVWKAFVRSRIKLVEHLFKYHEFTVDVITPKDKCTIQKYLFSIDTWTLEELKICAN
FT                   SIYFFEEDLQIQFLNQVIKAIHSYKNYDRARRVLCTLLINTIEMFISRGQLSSASKLII
FT                   LLDSLCLYNESAFYRNISHFLKGLVKMQNNHIQEGYNQAKKAIQIMNDLRFEEIAYLYE
FT                   ILLDQFIRIKGIDIVKS"
     MVGYGKTVRD IRTSKGIHQK DLYDNIISKS FAIEFEKGKH DITLTLFEKI LKRMNMDLDE        60
     FFYIHRELSV SAEKNYLCMN QERGNIYDLA SLELLYNELS KHNGELVEVW KAFVRSRIKL       120
     VEHLFKYHEF TVDVITPKDK CTIQKYLFSI DTWTLEELKI CANSIYFFEE DLQIQFLNQV       180
     IKAIHSYKNY DRARRVLCTL LINTIEMFIS RGQLSSASKL IILLDSLCLY NESAFYRNIS       240
     HFLKGLVKMQ NNHIQEGYNQ AKKAIQIMND LRFEEIAYLY EILLDQFIRI KGIDIVKS         298
//

If you have problems or comments...

PBIL Back to PBIL home page