(data stored in ACNUC10821 zone)

EMBL: AE017262.PE685

AE017262.PE685       Location/Qualifiers
FT   CDS             712807..713478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0693.1"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AB1110"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0693.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03475"
FT                   /protein_id="AAT03475.1"
FT                   /translation="MMVVKQMDDWSTLIGELEHNTPEKVWIVREELNISEVFEIQKLEA
FT                   HFILVLEGVLRMENEHQQILHYFRENNVIYQSPYELRVQNKLRLVAETPAHIVLLHREF
FT                   FLNYATNQPAYSEKLVRAIMDNAASFMFELMKNDLKSEDRLAYSLQQLCQSLELEVKNE
FT                   FYLLPHYINKNKLALYSDISRKSLYKYLQNLERKGQIKMNGNQILVRISRFTNSENVDW
FT                   L"
     MMVVKQMDDW STLIGELEHN TPEKVWIVRE ELNISEVFEI QKLEAHFILV LEGVLRMENE        60
     HQQILHYFRE NNVIYQSPYE LRVQNKLRLV AETPAHIVLL HREFFLNYAT NQPAYSEKLV       120
     RAIMDNAASF MFELMKNDLK SEDRLAYSLQ QLCQSLELEV KNEFYLLPHY INKNKLALYS       180
     DISRKSLYKY LQNLERKGQI KMNGNQILVR ISRFTNSENV DWL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page