(data stored in ACNUC10821 zone)

EMBL: AE017262.PE686

AE017262.PE686       Location/Qualifiers
FT   CDS             713667..715283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0694"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03476"
FT                   /protein_id="AAT03476.1"
FT                   /translation="MKLGKVGALLLGTALVFQAPFQVFATSVNGEEQVKKEAAAPKISV
FT                   NKQTLAATSDLEQTVGEAITKTIHLQDQALPNNEWGSYISDVKVTLSNMDGISYDVKYG
FT                   PLSEDGTHYQYADITLSGAPTKAGTGSISLEYYDGAGNGGVYSYSVNTKSKTTIQYVDG
FT                   DGNKLAEDTVKTGDLNTAYTSEPKTIDGYEVDETKLPSNQNGQFAETNQTVTYIYSKTK
FT                   SEVNKGTVGISFYTPDGSRRELKSSLDLSYAYPDGVPTDTVTFGDLAKNTTYKDLRNTP
FT                   DAPTLLWNDLLHYMVDYMNGDIDAAQFEEAVGLTPANFDLDFISRNFEGYKFDEAMYQE
FT                   NLSKLVTFEQDGDQVDLQVPFKKVEVGADITVKYVDTAGNELASVETLSGDVDDNYTSE
FT                   AKTIDGWTLKETPNNATGVFSKEAQTVTYVYEKNEDTDVTPAPDNSADTNDDNYSTDNT
FT                   ATTDDNSSSTVKEKAQTQASGPKEEKVTTQESTSNKVTTQPKESLPKTGDNVLESSLLL
FT                   GLGMLLLGGLFVFLRKTRKVK"
     MKLGKVGALL LGTALVFQAP FQVFATSVNG EEQVKKEAAA PKISVNKQTL AATSDLEQTV        60
     GEAITKTIHL QDQALPNNEW GSYISDVKVT LSNMDGISYD VKYGPLSEDG THYQYADITL       120
     SGAPTKAGTG SISLEYYDGA GNGGVYSYSV NTKSKTTIQY VDGDGNKLAE DTVKTGDLNT       180
     AYTSEPKTID GYEVDETKLP SNQNGQFAET NQTVTYIYSK TKSEVNKGTV GISFYTPDGS       240
     RRELKSSLDL SYAYPDGVPT DTVTFGDLAK NTTYKDLRNT PDAPTLLWND LLHYMVDYMN       300
     GDIDAAQFEE AVGLTPANFD LDFISRNFEG YKFDEAMYQE NLSKLVTFEQ DGDQVDLQVP       360
     FKKVEVGADI TVKYVDTAGN ELASVETLSG DVDDNYTSEA KTIDGWTLKE TPNNATGVFS       420
     KEAQTVTYVY EKNEDTDVTP APDNSADTND DNYSTDNTAT TDDNSSSTVK EKAQTQASGP       480
     KEEKVTTQES TSNKVTTQPK ESLPKTGDNV LESSLLLGLG MLLLGGLFVF LRKTRKVK         538
//

If you have problems or comments...

PBIL Back to PBIL home page