(data stored in ACNUC10821 zone)

EMBL: AE017262.PE689

AE017262.PE689       Location/Qualifiers
FT   CDS             complement(716581..717447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0697"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03479"
FT                   /protein_id="AAT03479.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVPAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
     MIKVIASDMD GTLLNSDIEI AQENVEAIEK ARAKGIHFVL CTGRMYDDAM GLINKANLYA        60
     PAICMNGAEI RDEHGKIILQ HPIDRNLARN TYNTLTELGM YTEFFTDMGP ITTDKARGKE       120
     FMIEMHKRIH PDVPAETIMD KVEERFESKD VHEIPDVERI LGNKDLTILK FISFSSDKDI       180
     LAKAKQKLEK DSELSVTSSF SDNIEITHRE AQKGISLQYY VEKLGVTLDE TFAIGDNMND       240
     ISMLKMAGYS VAMGNGEEEV KDLAEHVTLS NDEHGVAAAI YKMLETND                    288
//

If you have problems or comments...

PBIL Back to PBIL home page