(data stored in ACNUC10821 zone)

EMBL: AE017262.PE69

AE017262.PE69        Location/Qualifiers
FT   CDS             71118..72314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0053"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02859"
FT                   /protein_id="AAT02859.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAKRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYVKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
     MNKTIEMDGT TYDFTYEDLV WSITFPKSKT RAKELAQLEL LEKPATHFTP AKISSDSDSY        60
     TISYEIAKRT YGFEQVRKMG REDKLRALRN IADLGELLNT RYTFFLHPDN LIFDINLVPS       120
     IVHRGIKNIL PPYELTEETF FKQYQCFVIA MFSKKFSFEN LYNGSLSGAR GTQFEKSILD       180
     AKTVQDIATI LEEAYVKEHA AVQKNMASVP KKKYSTFRGL AVGFIIVAIL LAIPVSYFAF       240
     VKVPLQNDLL TANENFLKTD YDKVITGLEN VDPEKMPQSV QYELAYSYVK GEKMSDKKKE       300
     NIMNTISLKS DAKNLLYWIY NGRGEFSKSL DIAKLLDDPT LAMYSLTKQI EQVQSDTTLS       360
     GDEKVEKLKT LEESLKEYDE KVNESTTTED ETTNTEAK                               398
//

If you have problems or comments...

PBIL Back to PBIL home page