(data stored in ACNUC10821 zone)

EMBL: AE017262.PE690

AE017262.PE690       Location/Qualifiers
FT   CDS             717621..718184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0698"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to OMNI:SP0074; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03480"
FT                   /protein_id="AAT03480.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDAMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   SFPDNVVLAGNPARVIKTIEVEEK"
     MKTELEKMIA GEMYDPSDRE LAHGRNRARK FCREINDAMD SESRASVLKR LFGGTKENVY        60
     VEPDFRVDYG SNIYVGENFY ANFDCVILDV CEVHIGDNCM MAPGVHIYTA THPLDPVERN       120
     SGLELGKPVE IGDNVWIGGR AIINPGVKLG NNVVVASGAV VTKSFPDNVV LAGNPARVIK       180
     TIEVEEK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page