(data stored in ACNUC10821 zone)

EMBL: AE017262.PE691

AE017262.PE691       Location/Qualifiers
FT   CDS             718181..718444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0666"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03481"
FT                   /protein_id="AAT03481.1"
FT                   /translation="MIIADSKIFEQMENELAKAKAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETTAAVEPIAIQSAEPAQIASMDGKKIELEDGANGDSLLDF"
     MIIADSKIFE QMENELAKAK AATTKASQDK HLHGLMLLVQ LAKTGDETTA AVEPIAIQSA        60
     EPAQIASMDG KKIELEDGAN GDSLLDF                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page