(data stored in ACNUC10821 zone)

EMBL: AE017262.PE692

AE017262.PE692       Location/Qualifiers
FT   CDS             718454..718831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0700"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03482"
FT                   /protein_id="AAT03482.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVVGLLMEKQASRLYTWAAILFSVGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
     MKKTIITGAI FAGLAVLLGA FGAHALKDVL GSYASTWETG VQYQMFHAGG ILVVGLLMEK        60
     QASRLYTWAA ILFSVGIVFF SGSLYVLSIS KVSILGAITP IGGVCFVVGW FLLILGVSRR       120
     TMSRY                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page