(data stored in ACNUC10821 zone)

EMBL: AE017262.PE693

AE017262.PE693       Location/Qualifiers
FT   CDS             718945..719880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0701"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03483"
FT                   /protein_id="AAT03483.1"
FT                   /translation="MTYALEIKGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGQVSVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAIKRSEKYLKQSNLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYEEAFEITGYNHVFEDKQTLSVEVERNQGVNHIFEQLSEHGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
     MTYALEIKGL RKIYSTGVEA LRGVDLTVEE GDFYALLGPN GAGKSTTIGI ITSLVNKTSG        60
     QVSVFGYDLD TDIVRAKQQI GLVPQEFNFN PFETVQQIVV NQAGYYGVSR KEAIKRSEKY       120
     LKQSNLWEKR NERARMLSGG MKRRLMIARA LMHEPKLLIL DEPTAGVDIE LRREMWTFLR       180
     ELNESGTTII LTTHYLEEAE MLCRNIGIIQ SGELIENTSM KSLLSKLQFE TFIFDLEPYE       240
     EAFEITGYNH VFEDKQTLSV EVERNQGVNH IFEQLSEHGI KVLSMRNKSN RLEELFLKIT       300
     EEKHQVGEKH V                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page