(data stored in ACNUC10821 zone)

EMBL: AE017262.PE696

AE017262.PE696       Location/Qualifiers
FT   CDS             720906..721787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0704"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03486"
FT                   /protein_id="AAT03486.1"
FT                   /translation="MNKENPLNKYHTGKFEKQRQDYPGLQSKMTPVPDTGESSYQGANK
FT                   LTGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDAQEVKAIVEEAGQKCVLL
FT                   PGDLRKEGLAKDLVKKAYNELGGLDILVLNAGLQQYQLDIQKLPAEQLRDTFEVNVFSV
FT                   VFAIQEALNYLKAGASIILTSSIQGVKPSAHLVDYAMTKSSLISLTKSLAAQLGGKGIR
FT                   INAVAPGPIWTALQISGGQPQDSIPAFGQDQPLGRAGQPAELASAYVLLASDEASYTTG
FT                   QVYGITGGAPIN"
     MNKENPLNKY HTGKFEKQRQ DYPGLQSKMT PVPDTGESSY QGANKLTGKK AFVTGGDSGI        60
     GRAAVIAYAR EGADVAINYH PDEEVDAQEV KAIVEEAGQK CVLLPGDLRK EGLAKDLVKK       120
     AYNELGGLDI LVLNAGLQQY QLDIQKLPAE QLRDTFEVNV FSVVFAIQEA LNYLKAGASI       180
     ILTSSIQGVK PSAHLVDYAM TKSSLISLTK SLAAQLGGKG IRINAVAPGP IWTALQISGG       240
     QPQDSIPAFG QDQPLGRAGQ PAELASAYVL LASDEASYTT GQVYGITGGA PIN              293
//

If you have problems or comments...

PBIL Back to PBIL home page