(data stored in ACNUC10821 zone)

EMBL: AE017262.PE699

AE017262.PE699       Location/Qualifiers
FT   CDS             723626..724054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0708"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05656"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03489"
FT                   /protein_id="AAT03489.1"
FT                   /translation="MGFLEAYKSFWRNYVNFSGRAPRSAYWYVVLWNVIIFVILYALAF
FT                   IFGISAIMEAAMGGTGMAGGGGAIVLVIILWLYLLAALLPTISLMVRRLHDSGKSGFFV
FT                   LLSLIPFAGGIIMLIFMCLESDGPNQYGDGDIDSKFDF"
     MGFLEAYKSF WRNYVNFSGR APRSAYWYVV LWNVIIFVIL YALAFIFGIS AIMEAAMGGT        60
     GMAGGGGAIV LVIILWLYLL AALLPTISLM VRRLHDSGKS GFFVLLSLIP FAGGIIMLIF       120
     MCLESDGPNQ YGDGDIDSKF DF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page