(data stored in ACNUC10821 zone)

EMBL: AE017262.PE70

AE017262.PE70        Location/Qualifiers
FT   CDS             72328..76821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0072"
FT                   /product="diarrheal toxin/FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02860"
FT                   /protein_id="AAT02860.1"
FT                   /translation="MNREALLIVSNGQQCHKNHLSPEKVVTIGNTIEHEITYPELAEAI
FT                   EVKYDEGSWNAGTTALQANQAVNVENLAFYLCQDLHTQVYDVVTNISVTFGVGIENDVT
FT                   LDDTKSDFILLRDAKEKLFKLQVLNGEVYHNFSLVTEDCVLEPGDQLYTDGVTITIGKD
FT                   ISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKPT
FT                   DGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMSAVTITMAILNYIKSRKKYKIDS
FT                   KQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHHD
FT                   FLTFRVGRGDEASSFFVEFQQEEFSQEKDELVEEAVKIKGQYLSINEVPVATDLMHGPV
FT                   GYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPEEEKADWDWMRWLPHANMRDVNV
FT                   RGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEKLYFTPHYVVLITDEKLVLDHTV
FT                   MEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPDH
FT                   LPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMYGVERVEELNIAGRWAKNETYKS
FT                   LAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVAF
FT                   LLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHIN
FT                   QYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQK
FT                   PSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELFQ
FT                   SAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVID
FT                   HIHAYTEASGIEALPRPWLPPLEERIFLPELHQVNTEELWSGEKQPLQATIGFLDIPQM
FT                   QAQEPLTINLAKDGHLAVFSSPGYGKSTFLQTITMDLARQHNSERLHIYLLDLGTNGLL
FT                   PLKKLPHVADTIMVDEEIKIGKLIRRLTLELKERKQKLSKYGVANISMYEKASKEEVPA
FT                   ILLVIDAFDSVGEAPYKDVFEKLIAQIAREGASVGIHLVMSAVRQNAIRVQMLASIKHQ
FT                   IPLFMIEPGESRSIVGKTDLTIEELPGRGLVKLEEPTVFQTALPVCADGTLEIIEKIQA
FT                   ESEAMFSEWNGSRPAPIPMVPEVINMLEYLENKQVQKSLSEGKTPIAVDFEDVLPVNLD
FT                   VQTDGNTLVLTDNPDVLERTMVSLTELIGQNMEVDIALYDNSSNRFQQYRNNVNIYAGE
FT                   ETTMNSASAQMVSVLEAREDGWKEIQRASNGEITLKMYVEELRPMYVLLTDSIYAAEQM
FT                   SLEARKNIVRLIENGPKLGIYFVSGSQTGILYRARDEISGELRKQKTGILLGRISDQNI
FT                   LSLINNIYKEALLAPYEAYYIKQGQYEKIKLIAPNQ"
     MNREALLIVS NGQQCHKNHL SPEKVVTIGN TIEHEITYPE LAEAIEVKYD EGSWNAGTTA        60
     LQANQAVNVE NLAFYLCQDL HTQVYDVVTN ISVTFGVGIE NDVTLDDTKS DFILLRDAKE       120
     KLFKLQVLNG EVYHNFSLVT EDCVLEPGDQ LYTDGVTITI GKDISVLAVK NRVTSKLAPL       180
     FAADNSFGED YPDYHRSPRI IYRAPEEKIS MAKPSSKPSK PTDGLIKIIL PPLIMVAITV       240
     MISIFQPRGL YIIMTIAMSA VTITMAILNY IKSRKKYKID SKQRVESYDL YLKRKTKELH       300
     ETSEKQRHAL TYHYPDVTEL EKMALRVDSR IYEKTMFHHD FLTFRVGRGD EASSFFVEFQ       360
     QEEFSQEKDE LVEEAVKIKG QYLSINEVPV ATDLMHGPVG YIGPRRLVLE QLQMLVMQTS       420
     LFHSYYDLQF ITIFPEEEKA DWDWMRWLPH ANMRDVNVRG FVYHERSRDQ VLNSLYQILK       480
     ERKQALTEQA SKQEKLYFTP HYVVLITDEK LVLDHTVMEF FNEDPSELGV SLVFVQDVME       540
     SLPEHVKTVV DIRDAKSGNI ILEQGDLVNR AFVPDHLPAD FDKEVISRAL APLNHLQNLK       600
     NSIPESVTFL EMYGVERVEE LNIAGRWAKN ETYKSLAVPL GLRGKDDIVQ LNLHEKAHGP       660
     HGLVAGTTGS GKSEIIQSYI ISLGVNFHPY EVAFLLIDYK GGGMANLFKN MPHLLGTITN       720
     LDGAQSMRAL ASIKAELQKR QRLFGEHDVN HINQYQKLYK QGKATEPMPH LFLISDEFAE       780
     LKSEQPEFMK ELVSTARIGR SLGIHLILAT QKPSGVVDDQ IWSNSKFKLA LKVQNASDSN       840
     EILKTPDAAE ITLPGRSYLQ VGNNEIYELF QSAWSGADYV PDKESTDYID TTIYAINDLG       900
     QYDILTEDLS GLDKKDDLTK LPSELDAVID HIHAYTEASG IEALPRPWLP PLEERIFLPE       960
     LHQVNTEELW SGEKQPLQAT IGFLDIPQMQ AQEPLTINLA KDGHLAVFSS PGYGKSTFLQ      1020
     TITMDLARQH NSERLHIYLL DLGTNGLLPL KKLPHVADTI MVDEEIKIGK LIRRLTLELK      1080
     ERKQKLSKYG VANISMYEKA SKEEVPAILL VIDAFDSVGE APYKDVFEKL IAQIAREGAS      1140
     VGIHLVMSAV RQNAIRVQML ASIKHQIPLF MIEPGESRSI VGKTDLTIEE LPGRGLVKLE      1200
     EPTVFQTALP VCADGTLEII EKIQAESEAM FSEWNGSRPA PIPMVPEVIN MLEYLENKQV      1260
     QKSLSEGKTP IAVDFEDVLP VNLDVQTDGN TLVLTDNPDV LERTMVSLTE LIGQNMEVDI      1320
     ALYDNSSNRF QQYRNNVNIY AGEETTMNSA SAQMVSVLEA REDGWKEIQR ASNGEITLKM      1380
     YVEELRPMYV LLTDSIYAAE QMSLEARKNI VRLIENGPKL GIYFVSGSQT GILYRARDEI      1440
     SGELRKQKTG ILLGRISDQN ILSLINNIYK EALLAPYEAY YIKQGQYEKI KLIAPNQ         1497
//

If you have problems or comments...

PBIL Back to PBIL home page