(data stored in ACNUC10821 zone)

EMBL: AE017262.PE702

AE017262.PE702       Location/Qualifiers
FT   CDS             725613..725927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0711"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0679"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03492"
FT                   /protein_id="AAT03492.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQANRTRKSENDLIKLK
FT                   DTLLISHQLRAVLLEADGEKVLAIISNNDIRTVSLKGKTDQNEALFRELLLKEETKENA
FT                   "
     MEYFLSLLKI IVLLAVLAGI SYFLVKKNKQ ANRTRKSEND LIKLKDTLLI SHQLRAVLLE        60
     ADGEKVLAII SNNDIRTVSL KGKTDQNEAL FRELLLKEET KENA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page