(data stored in ACNUC10821 zone)

EMBL: AE017262.PE709

AE017262.PE709       Location/Qualifiers
FT   CDS             732162..732941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0718"
FT                   /product="putative flagellar basal-body rod protein"
FT                   /note="identified by similarity to SP:P23446; match to
FT                   protein family HMM PF00460"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03499"
FT                   /protein_id="AAT03499.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISR
FT                   NKVNYQNGPVARQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDTDPTQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAIQVGQKTSIRSEANGDLYNAE
FT                   TGQYLGRLGTKFVSANQADSLVKDGEGRLHVNGINTMNLPAGQGIIQNGVIETSNVDLG
FT                   VEMVQLMDNQRMVQASKNVVNMFDKVYDKEATGLIRQ"
     MKGLYIGAAG MMNYMQHIQV HSNNVANAQT PGFKFDQLTS EVISRNKVNY QNGPVARQVG        60
     TIDYGVRPAA THINLTAGSS YITNRDRDFF MQDTDPTQGS NFFITAKNGE ISLSRGGQFH       120
     SDQFGFLRTA DGANLLSATG EAIQVGQKTS IRSEANGDLY NAETGQYLGR LGTKFVSANQ       180
     ADSLVKDGEG RLHVNGINTM NLPAGQGIIQ NGVIETSNVD LGVEMVQLMD NQRMVQASKN       240
     VVNMFDKVYD KEATGLIRQ                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page