(data stored in ACNUC10821 zone)

EMBL: AE017262.PE71

AE017262.PE71        Location/Qualifiers
FT   CDS             76841..77236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0073"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02861"
FT                   /protein_id="AAT02861.1"
FT                   /translation="MGLTDFWKTPTEKKRDEYDKLHDYLKDALKKHDEKMAEVKSDLSA
FT                   YKKGMPDMPSKGIPANPFVEKNEKVLEQLEKYIDKEKDKRASLKSAIDTAYRKYLEYKA
FT                   LAIKEEKAEQAKKEKEKKEREERLKNG"
     MGLTDFWKTP TEKKRDEYDK LHDYLKDALK KHDEKMAEVK SDLSAYKKGM PDMPSKGIPA        60
     NPFVEKNEKV LEQLEKYIDK EKDKRASLKS AIDTAYRKYL EYKALAIKEE KAEQAKKEKE       120
     KKEREERLKN G                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page