(data stored in ACNUC10821 zone)

EMBL: AE017262.PE715

AE017262.PE715       Location/Qualifiers
FT   CDS             736316..738229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0724"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03505"
FT                   /protein_id="AAT03505.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKE
FT                   IAQEFTDFVYDFEWTGNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPI
FT                   EPIQMAQIISFTGEKGRVTTTNQMARVYKNDGTICFRGVIHEQLEAVDKHPIAAGVAEV
FT                   KIYHYGYMTEIVEKQDKSDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEF
FT                   SEAFRLRDHNHYIWAKLSAYHIAELLEQEKRYDESLAIIEEARIIWPNVPEFPLKKANI
FT                   LYVNHQLEDAKEIYQSLLENTAIDYQSIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIATIRNVFPVISESAILFGIKEELIDAADLCLWHY
FT                   ENPQLPIENVMKNSDVGDIYDFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRN
FT                   VYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDAEVLDEALAI
FT                   AERGIDNFSTDFRFYLWTIKIDTENRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTN
FT                   NR"
     MRPLISICMI VKNEAHILRQ SLASFRKFTE EIIIVDTGST DETKEIAQEF TDFVYDFEWT        60
     GNFSDARNFA AKHATGKWIL AIDADECLEE ESYRKLEKQL KSPIEPIQMA QIISFTGEKG       120
     RVTTTNQMAR VYKNDGTICF RGVIHEQLEA VDKHPIAAGV AEVKIYHYGY MTEIVEKQDK       180
     SDRNLRLLEK EVKNNKNSGF VHFNIGQEMN RLGNKKEALK EFSEAFRLRD HNHYIWAKLS       240
     AYHIAELLEQ EKRYDESLAI IEEARIIWPN VPEFPLKKAN ILYVNHQLED AKEIYQSLLE       300
     NTAIDYQSIV LYEATNFMPH KMLGTIYLEE KDYTRAMTHF SKAYAENSSD YGVMFQMIML       360
     LSKFHQPKEI FAFMERHHFI SSTETGLRLL SMTTQQGYAE LSELIVQSLT DVYPPVAEAT       420
     EVKIATIRNV FPVISESAIL FGIKEELIDA ADLCLWHYEN PQLPIENVMK NSDVGDIYDF       480
     IFENGPRISK KRYLFVLERA IALGKGEFAD YLLALRNVYH DSINSHIADL FFQYDFADIA       540
     LDFYNIVDAD EVTKQGYINL INYLVDAEVL DEALAIAERG IDNFSTDFRF YLWTIKIDTE       600
     NRANRISEAM DEFPNNRYLA KLLDEVTMLQ DTVTNNR                                637
//

If you have problems or comments...

PBIL Back to PBIL home page