(data stored in ACNUC10821 zone)

EMBL: AE017262.PE72

AE017262.PE72        Location/Qualifiers
FT   CDS             77229..77528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02862"
FT                   /protein_id="AAT02862.1"
FT                   /translation="MGNVKIDAAKVAEAKKSAAIVEKSLESTHKKCKSVISYVEGASWS
FT                   GKSRDAFLTFMELIEKYHADVKKNYKKQKKALTALEDYVEDFENTSYSKDVKRL"
     MGNVKIDAAK VAEAKKSAAI VEKSLESTHK KCKSVISYVE GASWSGKSRD AFLTFMELIE        60
     KYHADVKKNY KKQKKALTAL EDYVEDFENT SYSKDVKRL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page