(data stored in ACNUC10821 zone)

EMBL: AE017262.PE720

AE017262.PE720       Location/Qualifiers
FT   CDS             742774..743073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0729"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by match to protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03510"
FT                   /protein_id="AAT03510.1"
FT                   /translation="MEQVFQVELPEWEPKEPSQEGREKGSIRQVDNIGVNLIVRLGKKE
FT                   MPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
     MEQVFQVELP EWEPKEPSQE GREKGSIRQV DNIGVNLIVR LGKKEMPVGD IAELSIGDVL        60
     EVEKKPGHKV EIFLDEKKVG IGEAILMDEN FGIVISEID                               99
//

If you have problems or comments...

PBIL Back to PBIL home page