(data stored in ACNUC10821 zone)

EMBL: AE017262.PE721

AE017262.PE721       Location/Qualifiers
FT   CDS             743092..743502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0730"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03511"
FT                   /protein_id="AAT03511.1"
FT                   /translation="MKQEAYNAVKMKVDQEKTAILKELQLLLSKREKVVEKLAHEKEVY
FT                   YSRTKKERLQVAVLAGSMQLDAFSPSRIQQMEREIHQISQYIKSNEQILEQLEEKGKQA
FT                   KKMYDDTRKKWQQLENKREEQTLRDLKMVLLK"
     MKQEAYNAVK MKVDQEKTAI LKELQLLLSK REKVVEKLAH EKEVYYSRTK KERLQVAVLA        60
     GSMQLDAFSP SRIQQMEREI HQISQYIKSN EQILEQLEEK GKQAKKMYDD TRKKWQQLEN       120
     KREEQTLRDL KMVLLK                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page