(data stored in ACNUC10821 zone)

EMBL: AE017262.PE724

AE017262.PE724       Location/Qualifiers
FT   CDS             745008..746243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0733"
FT                   /product="putative flagellar hook protein FlgE"
FT                   /note="identified by similarity to SP:P75937; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429; match to protein family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03514"
FT                   /protein_id="AAT03514.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMGLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
     MNQTMYTAIS GMNAFQQALS VTSNNIANAN TTGYKKQSVV FNDLLYQNTM GSVAGGLYAG        60
     TNPMSFGSGS KIGAILTDYT AGSPTATGRN KDAALQGRGF FIAGDNAGGN IVYTRDGSFA       120
     VSDNNYLTTQ QGKYVMGYAT DKNGNVLNGN LQPIQIPLNS AIPGEATKNG SLSGNIPLDW       180
     GEKDTISSEL SVYDNAGGKH KLQVNMKAAT PDASGNVSYE YEIQMDGKAL TPPVTGTLNY       240
     NAQGELTNPD ALKNIQINST VNGKQVNMGL NLSGLTNYGT NQVFSPTSDG KGAATVKDYA       300
     VTDSGYIAVS YSDGTVIPVA QLAVATFSNE DGLVKMGNGE YVPGLSSGDA VYGVAGQNGA       360
     GGISGSSLEG SNVDLSREFV NLMTYQSGFQ GNTKVIRVAD DVMKQIVNLI Q                411
//

If you have problems or comments...

PBIL Back to PBIL home page