(data stored in ACNUC10821 zone)

EMBL: AE017262.PE725

AE017262.PE725       Location/Qualifiers
FT   CDS             746257..746493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0734"
FT                   /product="putative flagellar motor switch protein"
FT                   /note="identified by similarity to SP:P15070; match to
FT                   protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03515"
FT                   /protein_id="AAT03515.1"
FT                   /translation="MKINHTIPLRIDFELGRTKQPVGSLLDVKKGTVFRLEDSTANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
     MKINHTIPLR IDFELGRTKQ PVGSLLDVKK GTVFRLEDST ANVVKITISG KCIGYGEILT        60
     KDGKMFVKIT KLGEGSSS                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page