(data stored in ACNUC10821 zone)

EMBL: AE017262.PE727

AE017262.PE727       Location/Qualifiers
FT   CDS             747542..749056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0736"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by similarity to GP:7009585; match to
FT                   protein family HMM PF01052; match to protein family HMM
FT                   PF04509"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03517"
FT                   /protein_id="AAT03517.1"
FT                   /translation="MELDVIGEIANISFGSASTVLSDLLHQQVTISTPKVEIVDLYNTK
FT                   DIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNEELSELHLSAVQ
FT                   EAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIKVGFDLIIGDLI
FT                   TSNLMQLIPIDKGHELAKRLLGDAVPEPEPVKEEISLTAEELDVFLEVCNIGIGSASTV
FT                   LSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTFIISKNAALIMA
FT                   DLMMMGDGLVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKIDISPPTMEFCNF
FT                   GDTMIQKNIEEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLMLGIQAKEVAEKE
FT                   ATTPAEIIEPEKLAEPVHQAVIEEKETLSEMEQILEDIPVTLEVVFGTAKVKLEKFISW
FT                   CEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
     MELDVIGEIA NISFGSASTV LSDLLHQQVT ISTPKVEIVD LYNTKDIDIP HVVLEVNFHK        60
     GIEMRNLFVL QSEVAAAIAD LMMMGDGNID PNEELSELHL SAVQEAMNQM MGHSATAMSN       120
     MFGEMIDITT PDIKVIALKE QLEDTNDQTM IKVGFDLIIG DLITSNLMQL IPIDKGHELA       180
     KRLLGDAVPE PEPVKEEISL TAEELDVFLE VCNIGIGSAS TVLSKLLNRK VSLQIPTARV       240
     IDSKEFEFNE RPCLVTSVEF VEGLRSSNTF IISKNAALIM ADLMMMGDGL VQEDAELTEL       300
     EVSAVQELMN QMMGFSATAM SEMLGTKIDI SPPTMEFCNF GDTMIQKNIE EGKTVEVIFP       360
     LEVEGLLKTP MYQIFNPAAA KEMAQLMLGI QAKEVAEKEA TTPAEIIEPE KLAEPVHQAV       420
     IEEKETLSEM EQILEDIPVT LEVVFGTAKV KLEKFISWCE KDVIILKESM NEPLVLALNG       480
     VTIGKGILVR VDDHFGIQMT ELVR                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page