(data stored in ACNUC10821 zone)

EMBL: AE017262.PE728

AE017262.PE728       Location/Qualifiers
FT   CDS             749080..750465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0737"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0705"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03518"
FT                   /protein_id="AAT03518.1"
FT                   /translation="MTILFWLFFSVQAFAADPEPPIISLEGEQHVFTSGEVISFHIENA
FT                   ADLKIILVNEHGQRKLLDEETYTVTDWDLDGSYQAEFYQADVPKPFVTVEDLFEVKQLE
FT                   DVAKDETAPSLKTIEITHDEDVLLTSVLRVSADLDDAESGVKQATLVVHSESNESEIEL
FT                   IRNNYTGKFAAEIPLEKFQLGEKITFQLQLVDFAENEITVDLENTVQLYQPKAPLLSYD
FT                   SNDITNVQKKIGQVGKQIELTLDKYTTEFPELETETGKIIPLKWQKTATEWKGSLTLPS
FT                   ELSGEIIHIQGMDQHLLVRATSEPFGEVQLVNNAILTGTILSDFTLISNLYIEVNGQKF
FT                   SVERAGNRFTSAEITTTGKIVLHWTDWDGQIYSKQMNQEIKPVIAMPGKEIIAPPPVIP
FT                   NEKTQILTSPAPKPSVEAHENTPKKQVKKETSTKDNSSSIPFWIPALMIIGVIIFSGNR
FT                   AMK"
     MTILFWLFFS VQAFAADPEP PIISLEGEQH VFTSGEVISF HIENAADLKI ILVNEHGQRK        60
     LLDEETYTVT DWDLDGSYQA EFYQADVPKP FVTVEDLFEV KQLEDVAKDE TAPSLKTIEI       120
     THDEDVLLTS VLRVSADLDD AESGVKQATL VVHSESNESE IELIRNNYTG KFAAEIPLEK       180
     FQLGEKITFQ LQLVDFAENE ITVDLENTVQ LYQPKAPLLS YDSNDITNVQ KKIGQVGKQI       240
     ELTLDKYTTE FPELETETGK IIPLKWQKTA TEWKGSLTLP SELSGEIIHI QGMDQHLLVR       300
     ATSEPFGEVQ LVNNAILTGT ILSDFTLISN LYIEVNGQKF SVERAGNRFT SAEITTTGKI       360
     VLHWTDWDGQ IYSKQMNQEI KPVIAMPGKE IIAPPPVIPN EKTQILTSPA PKPSVEAHEN       420
     TPKKQVKKET STKDNSSSIP FWIPALMIIG VIIFSGNRAM K                           461
//

If you have problems or comments...

PBIL Back to PBIL home page