(data stored in ACNUC10821 zone)

EMBL: AE017262.PE729

AE017262.PE729       Location/Qualifiers
FT   CDS             750488..751654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0738"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0706"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03519"
FT                   /protein_id="AAT03519.1"
FT                   /translation="MKIDGIQESAENRNQLERELIKQNPVVKEGTIKAQMNTEVAVPKT
FT                   PPVSFSFKELSSLQLNGTSAASLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQ
FT                   TVRSEISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETT
FT                   GKYDFLRMMQIASGNMETGIQMMREFQGHIEHATRLDPIVDARQETNWMIKVLREFGNM
FT                   FQSRHLLPYELQAENINIWKLGSEYLKLMNQLLPQIGAFPNGNIKIFHQQATKPLTELF
FT                   QELQRLADGQMTQGGIAVILDRMQGQLTRLAQLFQKMEIEAGFTDTERILGSVDAEFAS
FT                   DMTKMMLLAQQEMSFFDLLVKDFRSVSKQPIFFMIVAIFIILLLIILF"
     MKIDGIQESA ENRNQLEREL IKQNPVVKEG TIKAQMNTEV AVPKTPPVSF SFKELSSLQL        60
     NGTSAASLEL YMKLMMNNAK KANDLIFYVM RAGIKNPTDS TKWQTVRSEI SSQLSTILMK       120
     QHNFEAYFSE NPANQKLFLA NQKIMNEISF LLKMLPTLTF ETTGKYDFLR MMQIASGNME       180
     TGIQMMREFQ GHIEHATRLD PIVDARQETN WMIKVLREFG NMFQSRHLLP YELQAENINI       240
     WKLGSEYLKL MNQLLPQIGA FPNGNIKIFH QQATKPLTEL FQELQRLADG QMTQGGIAVI       300
     LDRMQGQLTR LAQLFQKMEI EAGFTDTERI LGSVDAEFAS DMTKMMLLAQ QEMSFFDLLV       360
     KDFRSVSKQP IFFMIVAIFI ILLLIILF                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page