(data stored in ACNUC10821 zone)

EMBL: AE017262.PE732

AE017262.PE732       Location/Qualifiers
FT   CDS             752683..754203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0741"
FT                   /product="flagellar hook-associated protein 1-related
FT                   protein"
FT                   /note="identified by similarity to SP:P33235; match to
FT                   protein family HMM PF01239; match to protein family HMM
FT                   PF06429; match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03522"
FT                   /protein_id="AAT03522.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAV
FT                   YGDGGLLGGKQTGYGVKVTDIKRLTNTALTTQYNNQIAKQSASLYQSGALGQALNLFGT
FT                   PGKNTPSDNLDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIA
FT                   ADTDAAIQDLNSLIKKLGSINKAIGNAGSNPPNDLLNQRDQLLSTMAGYAGISVSAHPN
FT                   NPDVYDVTIGGRLVVQGDETTEITSTRTATGFEFSVDGQKLNMPEGSIIASVRVNQNEI
FT                   KSYQEKIETFSNSLAKALDDIQVKNVNKTMDDLQKINDALKANPNDEKLLSNRDELLRQ
FT                   LEKFPGVTRSGDTLTIGGVDHAIGTLGTSTYVTDVNDFSIPIFTQSSGKWILNPAITSN
FT                   ADNKPFLGVIAADIASLKTDKNIQGTTFPSFMDGIITEVATDASKSSATSTADTQALNS
FT                   LSESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
     MRLSDFNTSL SGMSAAQIAN MVAQQNISNM NTPGYIRQAV DQTAVYGDGG LLGGKQTGYG        60
     VKVTDIKRLT NTALTTQYNN QIAKQSASLY QSGALGQALN LFGTPGKNTP SDNLDNFFTA       120
     WAALAKNPDQ ATNTTALLSS MSIFTDQLNQ LHSGLKELET TIAADTDAAI QDLNSLIKKL       180
     GSINKAIGNA GSNPPNDLLN QRDQLLSTMA GYAGISVSAH PNNPDVYDVT IGGRLVVQGD       240
     ETTEITSTRT ATGFEFSVDG QKLNMPEGSI IASVRVNQNE IKSYQEKIET FSNSLAKALD       300
     DIQVKNVNKT MDDLQKINDA LKANPNDEKL LSNRDELLRQ LEKFPGVTRS GDTLTIGGVD       360
     HAIGTLGTST YVTDVNDFSI PIFTQSSGKW ILNPAITSNA DNKPFLGVIA ADIASLKTDK       420
     NIQGTTFPSF MDGIITEVAT DASKSSATST ADTQALNSLS ESKSSLEGVN IDEEMTNIMQ       480
     YQSYYVANTK AMNTVNDMMK ALLAML                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page