(data stored in ACNUC10821 zone)

EMBL: AE017262.PE735

AE017262.PE735       Location/Qualifiers
FT   CDS             756410..756796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0744"
FT                   /product="putative flagellar protein FliS"
FT                   /note="identified by similarity to SP:P39739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03525"
FT                   /protein_id="AAT03525.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLDKALEQLHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
     MQAWKRYTQN ELNTSNPIKN TIYIYERCII EFKKLDKALE QLHFSEADLI LDKMEKIFEE        60
     LKLQLNPEAG QELYDNIFGL YEWISEQIRQ MQLLKQPVNI DTIIHVITQL KEGYEGVMKH       120
     ESSKDTFG                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page