(data stored in ACNUC10821 zone)

EMBL: AE017262.PE74

AE017262.PE74        Location/Qualifiers
FT   CDS             78227..78559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02864"
FT                   /protein_id="AAT02864.1"
FT                   /translation="MAQQTMGGAGAASTIDINPDEMTHIAKELLAIANEFEGVIKPAVN
FT                   QLKANKYLTKGKAKKAMDKVPKANERVMELQDQYNMASSVVFDILQTMVDADRDIAEKI
FT                   IAALEV"
     MAQQTMGGAG AASTIDINPD EMTHIAKELL AIANEFEGVI KPAVNQLKAN KYLTKGKAKK        60
     AMDKVPKANE RVMELQDQYN MASSVVFDIL QTMVDADRDI AEKIIAALEV                  110
//

If you have problems or comments...

PBIL Back to PBIL home page