(data stored in ACNUC10821 zone)

EMBL: AE017262.PE742

AE017262.PE742       Location/Qualifiers
FT   CDS             761022..761714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03532"
FT                   /protein_id="AAT03532.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEETEEVESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELKREAETEIEANKQAFEKEKTQ
FT                   MYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
     MSLSNPRIPK GKVTLSDVKM ELFYLDDIEE TEEVESPYSK ELEQLESHQK ELEKHLSAIE        60
     IEQQKLANEK AALQAERQAI EELKREAETE IEANKQAFEK EKTQMYLTIT DFLWDESIDL       120
     AERIVHQAID TRQIEVLPML TEVIQKLPVA FDKLNVTTHP ETLKALKEEN TGTKYDWLLE       180
     NIHWNFDMRL DYGEFTVEEE KEYFDYRITE IFQTLHKQNA ERKILGGDKP                  230
//

If you have problems or comments...

PBIL Back to PBIL home page