(data stored in ACNUC10821 zone)

EMBL: AE017262.PE745

AE017262.PE745       Location/Qualifiers
FT   CDS             763711..764355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0754"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0722"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03535"
FT                   /protein_id="AAT03535.1"
FT                   /translation="MGNWQQKWESWRDMTAAMQQEIKIEAAEKVTSYIKNDQFEEAINV
FT                   IRQTENLLNELDFETKMNRVEEQLQAFTSDQEAAKSFEASQLQNLEKPSTKVSFDLSHV
FT                   KSEAINQFTKRDFNLVDSNDTHMQFLKGNRNFYMDIFNPEESEEYHYANLDEKCQYKNI
FT                   GFICQNDAAAEIATKLTNEWLETLEAPKKKFLTVNIANLNAMKQNQEVLFQ"
     MGNWQQKWES WRDMTAAMQQ EIKIEAAEKV TSYIKNDQFE EAINVIRQTE NLLNELDFET        60
     KMNRVEEQLQ AFTSDQEAAK SFEASQLQNL EKPSTKVSFD LSHVKSEAIN QFTKRDFNLV       120
     DSNDTHMQFL KGNRNFYMDI FNPEESEEYH YANLDEKCQY KNIGFICQND AAAEIATKLT       180
     NEWLETLEAP KKKFLTVNIA NLNAMKQNQE VLFQ                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page