(data stored in ACNUC10821 zone)

EMBL: AE017262.PE747

AE017262.PE747       Location/Qualifiers
FT   CDS             764800..765123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0756"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0724; match
FT                   to protein family HMM PF06304"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03537"
FT                   /protein_id="AAT03537.1"
FT                   /translation="MFNWYKKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK
FT                   GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRD
FT                   SIK"
     MFNWYKKYRE EKRDYKQYKK RIAALPEDYK TAMKAIETYL WNFAKGAGMF EILKNVLEMF        60
     ENAAADNLEL KAVVGDDLAE FADNLLSEFP EETWMDKQRQ KLRDSIK                     107
//

If you have problems or comments...

PBIL Back to PBIL home page