(data stored in ACNUC10821 zone)

EMBL: AE017262.PE749

AE017262.PE749       Location/Qualifiers
FT   CDS             766084..767814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0758"
FT                   /product="pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /note="identified by similarity to SP:P37063; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03539"
FT                   /protein_id="AAT03539.1"
FT                   /translation="MKKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKEQEAIE
FT                   FIHVRHEEVATLAAAAYTKLTGKIGVALSIGGPGAIHLLNGMYDAKMDHVPMLVLAGQV
FT                   TTDVLNTGFFQEVNLPAIFEDVAVYNKQIDNAETLADVVDEAIRTAYKEKGVAVLTIPN
FT                   DIPSQVIKASLEAKPVKFEQENPKLDEAAIQEAVARIEKAEKPVILAGLGTKHAGPELI
FT                   AFSEKLKIPIIHSLPAKTIVPDNHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYS
FT                   DYLPKKADCIQIDIDPAKISKRFPATVGLVGDAAEIIGNLTAKTAPVEERKFLQACQEN
FT                   MQEWWKWLEEDIAQTTDPIAPEVVMANIQKIADKDAIFSIDVGTATVWSTRYLHLAPQN
FT                   DFIVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGLNMPMIVV
FT                   VLNNQQLSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLEAAFENAK
FT                   LATKPVIIDVSVDSAAAPLPGKIVMDEALGYTKFEIQSVLEDHRFAKMPPLKTILRRFL
FT                   "
     MKKVKASETL VQTLKNWGID HVYGLPGDSI DTVVDALRKE QEAIEFIHVR HEEVATLAAA        60
     AYTKLTGKIG VALSIGGPGA IHLLNGMYDA KMDHVPMLVL AGQVTTDVLN TGFFQEVNLP       120
     AIFEDVAVYN KQIDNAETLA DVVDEAIRTA YKEKGVAVLT IPNDIPSQVI KASLEAKPVK       180
     FEQENPKLDE AAIQEAVARI EKAEKPVILA GLGTKHAGPE LIAFSEKLKI PIIHSLPAKT       240
     IVPDNHPNAL GNLGKIGTKP AYEAMQETDL LLMFGNDYPY SDYLPKKADC IQIDIDPAKI       300
     SKRFPATVGL VGDAAEIIGN LTAKTAPVEE RKFLQACQEN MQEWWKWLEE DIAQTTDPIA       360
     PEVVMANIQK IADKDAIFSI DVGTATVWST RYLHLAPQND FIVSAWLGTM GCGLPGAIAA       420
     KKAFPDRQAI AIVGDGGFSM VMQDFVTAVG LNMPMIVVVL NNQQLSFIKY EQQSAGELNY       480
     AIDLPDINYA KFAESCGGIG FRVEKMADLE AAFENAKLAT KPVIIDVSVD SAAAPLPGKI       540
     VMDEALGYTK FEIQSVLEDH RFAKMPPLKT ILRRFL                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page