(data stored in ACNUC10821 zone)

EMBL: AE017262.PE750

AE017262.PE750       Location/Qualifiers
FT   CDS             767976..769781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0759"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to SP:P39216; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03540"
FT                   /protein_id="AAT03540.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSALIKDIDDLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKSSASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNEMNYKEVENSSQAISDFGVKISIIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLNRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEVTEEPESETKDPGEPVLAENV"
     MNLIKNRKLK TKLSINIVIT TIMLIGLGAT SFLGFRHVAT LSDNMVDNNV APMKEIAKIQ        60
     TNMAQINIDI LTMFDTINGK SALIKDIDDL YAENDQAIHN FKKANLTAED KKQLAYFEEK       120
     LADMKSSASS VISDTSSALD DAELLGAQNR YYQNVKTKFD DATKQLNVLN EMNYKEVENS       180
     SQAISDFGVK ISIIFTAVII AVLISLFIFN AYITRVILKG IRHLQTAVHK VASGDLSYRS       240
     TYNGRDELGD ITNDLNEMSE NLRLMIEDVK KASTDVKSSS DNVIISSEII SAMTTEMDIE       300
     MKMMGEQIQT QIGSMKESTD AMDQMTGGVQ NVAEYALKVS DLTKDSAEKT NDGIAVINNL       360
     VSQMDRISGV MRSSTDVVSQ LVNRVGEVEK ALDTVTNIAD QTNLLALNAA IESARAGEHG       420
     RGFAVVAEEV RKLAEQSRLA VVDINTVLKK IQTESKTTIE VMNTGLSESE AGQKIISETE       480
     ATFTDLLNRV NDISAQMQNV SQETEEMAAG IEEVNTSISD VTEISNQIGE KSTAALEFAE       540
     VNKMKVDELV VISEEMQKIS GSLEGYIANF NTEVSEEAVE VTEEPESETK DPGEPVLAEN       600
     V                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page