(data stored in ACNUC10821 zone)

EMBL: AE017262.PE751

AE017262.PE751       Location/Qualifiers
FT   CDS             769794..770522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0760"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0728"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03541"
FT                   /protein_id="AAT03541.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLDN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFNGKRVTKNELANNLPTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIANLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVVITGFDKDNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSHP"
     MRIWIKSLLV ITACIFSLTL LNTKYTFYSP TVKLESAKVV YKLDNEPFNV RLDVPLVNQM        60
     DAPTLFNGCE VTSLAMLLQF NGKRVTKNEL ANNLPTTPIE QNGLHGNPDK AFVGSISGDS       120
     PGLGVNHAPI ANLAAKYVNE AHVHDISGNS IQDIITVLST GAPVWIITTT DYHAPKNWQT       180
     VQTKEGKKKI TYSMHSVVIT GFDKDNFYIN DPYGHKNRAV KRSVLEEGWS AMGKQAIYLS       240
     HP                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page