(data stored in ACNUC10821 zone)

EMBL: AE017262.PE76

AE017262.PE76        Location/Qualifiers
FT   CDS             80262..80651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0063"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02866"
FT                   /protein_id="AAT02866.1"
FT                   /translation="MLNTVNGELKINDELIVHPEYQFDEFKNTEYYDGQDGIKIIYLEK
FT                   IQKIDTYHYFVNLFFKEKQLYSVSLINCDQNISESNEIDRKTIHDKILSENGIQNNVSY
FT                   NWGKIISEYDPRSNISSIDIFYNIR"
     MLNTVNGELK INDELIVHPE YQFDEFKNTE YYDGQDGIKI IYLEKIQKID TYHYFVNLFF        60
     KEKQLYSVSL INCDQNISES NEIDRKTIHD KILSENGIQN NVSYNWGKII SEYDPRSNIS       120
     SIDIFYNIR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page