(data stored in ACNUC10821 zone)

EMBL: AE017262.PE79

AE017262.PE79        Location/Qualifiers
FT   CDS             81770..82093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19715005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02869"
FT                   /protein_id="AAT02869.1"
FT                   /translation="MLNIKSGEQLSIGLPENVPRLLENNLITYFEKNQKINSAYLLQIV
FT                   RRQRDKSLLLVVDFNGGEGEFQRTVRELEMSITTEDIFEVISLDTDFSKEITEGKTPIY
FT                   NKQ"
     MLNIKSGEQL SIGLPENVPR LLENNLITYF EKNQKINSAY LLQIVRRQRD KSLLLVVDFN        60
     GGEGEFQRTV RELEMSITTE DIFEVISLDT DFSKEITEGK TPIYNKQ                     107
//

If you have problems or comments...

PBIL Back to PBIL home page