(data stored in ACNUC10821 zone)

EMBL: AE017262.PE80

AE017262.PE80        Location/Qualifiers
FT   CDS             82350..84047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02870"
FT                   /protein_id="AAT02870.1"
FT                   /translation="MKEVNYREDDWREAKSALAPFAAANWVGGLFNNLEKVSKNMEEAE
FT                   EDIQELDSDHAISFQHTNYRGKYSAIEDDLMVLYKFSCHAGEKMETLVDQPFYEKLDAF
FT                   VDGMQDLSISTYSTTNRIGAKSKQTYMSSYGNQPQVIESVKDNATIEDLMNGDNFYANQ
FT                   MQLQYRDWQRANPDQDVSKKDFQMGMLHSRAFEYKSIKDEQQEKEFWVNIVATVVIVGV
FT                   SIFCPPAGLALAVGYGSLEAGSAISGKDWVSGRELSAEERALRGGLALLDIVPGVKALS
FT                   TGAKAASAGSKLVRVGDNALAGSKNVGKGTIDNGIQAGKQAMDLRLANAKKVSEAVQKK
FT                   LTKDLDDIGTMAKTIQNKTKETFTLPPREQLAFAGGGSISEQSAAGAASKKKLQDMMRR
FT                   MDNLNVKGGGKDDIIKGASGAESKIDGELIRKYVRDVETQTNRKIPKKQMEELKNALRN
FT                   TEYKKMTPSETKRYRREFNKIKNSLIDEWEKQTDQIWPTYTEDVISEKTGKVLRKKGEL
FT                   YDAHHIIENSYGGEHKWWNIHPAKFPDEHQGGIHGSGAPGNELYNGGK"
     MKEVNYREDD WREAKSALAP FAAANWVGGL FNNLEKVSKN MEEAEEDIQE LDSDHAISFQ        60
     HTNYRGKYSA IEDDLMVLYK FSCHAGEKME TLVDQPFYEK LDAFVDGMQD LSISTYSTTN       120
     RIGAKSKQTY MSSYGNQPQV IESVKDNATI EDLMNGDNFY ANQMQLQYRD WQRANPDQDV       180
     SKKDFQMGML HSRAFEYKSI KDEQQEKEFW VNIVATVVIV GVSIFCPPAG LALAVGYGSL       240
     EAGSAISGKD WVSGRELSAE ERALRGGLAL LDIVPGVKAL STGAKAASAG SKLVRVGDNA       300
     LAGSKNVGKG TIDNGIQAGK QAMDLRLANA KKVSEAVQKK LTKDLDDIGT MAKTIQNKTK       360
     ETFTLPPREQ LAFAGGGSIS EQSAAGAASK KKLQDMMRRM DNLNVKGGGK DDIIKGASGA       420
     ESKIDGELIR KYVRDVETQT NRKIPKKQME ELKNALRNTE YKKMTPSETK RYRREFNKIK       480
     NSLIDEWEKQ TDQIWPTYTE DVISEKTGKV LRKKGELYDA HHIIENSYGG EHKWWNIHPA       540
     KFPDEHQGGI HGSGAPGNEL YNGGK                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page