(data stored in ACNUC10821 zone)

EMBL: AE017262.PE85

AE017262.PE85        Location/Qualifiers
FT   CDS             86538..87260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0087"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02875"
FT                   /protein_id="AAT02875.1"
FT                   /translation="MKKNLEQIYAIEFTMGLRYRPMQIRHNIKLIFLLLLFVTWLQGDF
FT                   MNRLPGNLDITKVDMPLVLLALLCYIILYPKKMTIRFQNLQYLLYICCFQFLVFMVIRY
FT                   FYSNLIYAIQNMVSLTAQTLVASYVFLLVLWVLAFIFFYFHFRKKLRNGDYRKDSELQK
FT                   KRSNLGLKLSKGSYILIGAFFVFILSSQIVGGIMVDIMIISIEIVGIALCSMGIVIFPE
FT                   QLFTAYCKFKFKEFHIEE"
     MKKNLEQIYA IEFTMGLRYR PMQIRHNIKL IFLLLLFVTW LQGDFMNRLP GNLDITKVDM        60
     PLVLLALLCY IILYPKKMTI RFQNLQYLLY ICCFQFLVFM VIRYFYSNLI YAIQNMVSLT       120
     AQTLVASYVF LLVLWVLAFI FFYFHFRKKL RNGDYRKDSE LQKKRSNLGL KLSKGSYILI       180
     GAFFVFILSS QIVGGIMVDI MIISIEIVGI ALCSMGIVIF PEQLFTAYCK FKFKEFHIEE       240
//

If you have problems or comments...

PBIL Back to PBIL home page