(data stored in ACNUC10821 zone)

EMBL: AE017262.PE87

AE017262.PE87        Location/Qualifiers
FT   CDS             88139..88240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02877"
FT                   /protein_id="AAT02877.1"
FT                   /translation="MKLPPEADYLNDETLEVYENDKKKYDQTKSTNY"
     MKLPPEADYL NDETLEVYEN DKKKYDQTKS TNY                                     33
//

If you have problems or comments...

PBIL Back to PBIL home page