(data stored in ACNUC10821 zone)

EMBL: AE017262.PE92

AE017262.PE92        Location/Qualifiers
FT   CDS             complement(91170..91883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0094"
FT                   /product="pentapeptide repeats domain protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02882"
FT                   /protein_id="AAT02882.1"
FT                   /translation="MKGKRFSAPFPSKIRYNESGSEVDIMKKITAPRIPDEDLTVYPND
FT                   TYFIEDIGEVSEQIFRKTTLTGEIFEHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCD
FT                   LSNLDLMGAIIHRVRFENCKLIGVNFSDATLRNCVFVDCYADYVAFRYANLKWVAFEAG
FT                   AYTNSDFSGAQLVDTYLERLDLNKAQFLNCALNGVDLSSCIFESITAMPQDLKGVSIDF
FT                   SHAPALMPLFGIRVK"
     MKGKRFSAPF PSKIRYNESG SEVDIMKKIT APRIPDEDLT VYPNDTYFIE DIGEVSEQIF        60
     RKTTLTGEIF EHFHLETIIF DGCVFDSVSL VSANLTDVVF KNCDLSNLDL MGAIIHRVRF       120
     ENCKLIGVNF SDATLRNCVF VDCYADYVAF RYANLKWVAF EAGAYTNSDF SGAQLVDTYL       180
     ERLDLNKAQF LNCALNGVDL SSCIFESITA MPQDLKGVSI DFSHAPALMP LFGIRVK          237
//

If you have problems or comments...

PBIL Back to PBIL home page